PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf15373g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 397aa    MW: 44242.7 Da    PI: 5.8755
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf15373g00012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.69.1e-083403732154
                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               k +yp++e++++L +++gL+ +q+ +WF N+R +
  Niben101Scf15373g00012.1 340 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 373
                               469*****************************87 PP

2ELK28.92.5e-10294315122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               ELKh+L+++Y+++++++++E++
  Niben101Scf15373g00012.1 294 ELKHELKQGYKEKIVDIREEIL 315
                               9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-19128172IPR005540KNOX1
PfamPF037903.5E-17130171IPR005540KNOX1
SMARTSM012566.4E-25181237IPR005541KNOX2
PfamPF037911.2E-18187236IPR005541KNOX2
PROSITE profilePS512139.969294314IPR005539ELK domain
PfamPF037899.1E-7294315IPR005539ELK domain
SMARTSM011886.1E-4294315IPR005539ELK domain
PROSITE profilePS5007111.726314377IPR001356Homeobox domain
SMARTSM003894.7E-11316381IPR001356Homeobox domain
SuperFamilySSF466895.13E-16316380IPR009057Homeodomain-like
CDDcd000868.24E-11317378No hitNo description
Gene3DG3DSA:1.10.10.603.3E-25321378IPR009057Homeodomain-like
PfamPF059201.1E-17334373IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MAFQDHFSQE MATLHQQQQN AAVLRSMLPE DHQSPRKSPP TWLNTSLLRQ HSSAAAVSAA  60
GGTGNNFLHL QTSNSDSSNS NNQWLSPTAA ASAGGGGGAE EHNDVNINNN NSNSNNNNEE  120
GENSWEREKC KADILNHPLY DQLLSAHVSC LRIATPVDQL PRIDAQLAQS QNVVAKYSVF  180
GQGQPPLDDK DLDQFMTHYV LLLSSFKEQL QQHVRVHAME AVMACWELEQ SLQSLTGVAP  240
GEGTGATMSD DDDDQADSDT NFLDGGFDGS DSMGFGPLVP TESERSLMER VRQELKHELK  300
QGYKEKIVDI REEILRKRRA GKLPGDTTSV LKAWWQSHSK WPYPTEEDKA RLVQETGLQL  360
KQINNWFINQ RKRNWHSNPS TSTSQKSKRK SAGEIKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12317381872Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505338.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X2
SwissprotO223000.0LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLA9CR840.0A9CR84_TOBAC; Class 2 knotted1-like protein
STRINGSolyc07g007120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-144KNOTTED1-like homeobox gene 3